PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013625304.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 278aa    MW: 32731.8 Da    PI: 9.4648
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013625304.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding569.4e-183683148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT++Ed +lv+ v+++G ++W+ Ia+  g++Rt+k+c++rw +yl
   XP_013625304.1 36 KGPWTEQEDIILVNFVHLFGDRRWDFIAKVSGLNRTGKSCRLRWVNYL 83
                     79********************************************97 PP

2Myb_DNA-binding54.52.7e-1789134148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T++E+ l  ++++++G++ W++Iar+++ gRt++++k++w++++
   XP_013625304.1  89 RGKMTPQEERLVTELHAKWGNR-WSKIARKLP-GRTDNEIKNYWRTHM 134
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.0943183IPR017930Myb domain
SMARTSM007177.6E-163585IPR001005SANT/Myb domain
SuperFamilySSF466891.58E-2935130IPR009057Homeodomain-like
PfamPF002492.1E-163683IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.8E-213789IPR009057Homeodomain-like
CDDcd001678.97E-113883No hitNo description
PROSITE profilePS5129426.73684138IPR017930Myb domain
SMARTSM007177.9E-1788136IPR001005SANT/Myb domain
PfamPF002491.8E-1589133IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-2390137IPR009057Homeodomain-like
CDDcd001674.38E-1191134No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 278 aa     Download sequence    Send to blast
MVKQAEKEHY SNIRDKERQR EKKKKEMNMM QEENRKGPWT EQEDIILVNF VHLFGDRRWD  60
FIAKVSGLNR TGKSCRLRWV NYLHPGLKRG KMTPQEERLV TELHAKWGNR WSKIARKLPG  120
RTDNEIKNYW RTHMRKKAQE KKRHVSPSSS CSNCCSSSMT TTNTQDVSFE SRMSSGKVSF  180
YDTGGNREMN QEETKDGYSM DDIWKEIDHS AVNIIQPVKD IYLEQSYCLS YPNLASPSWE  240
SSLDSIWKME EDKSKMSSFA NDQFPFCFQH SRSPWSSG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A1e-27361384105MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11925REKKKKE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC9667380.0KC966738.1 Brassica napus MYB transcription factor 48 (MYB48.1) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013625304.10.0PREDICTED: transcription factor MYB48
SwissprotQ9LX821e-147MYB48_ARATH; Transcription factor MYB48
TrEMBLA0A0D3BHG50.0A0A0D3BHG5_BRAOL; Uncharacterized protein
STRINGBra018223.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM25022774
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G46130.11e-141myb domain protein 48